PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 135aa    MW: 15528.9 Da    PI: 8.4952
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58809.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.4e-26959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                k+i+n + rqv fskRr g++KKA+ELS+LCdae+ +++fsstgkl++y+s
  EPS58809.1  9 KKIDNVTARQVAFSKRRRGLFKKAHELSTLCDAEIGLVVFSSTGKLFDYAS 59
                68***********************************************86 PP

2K-box31.29.3e-1275133765
       K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkki 65 
                 +s+e+++++  ++ +a + ke+      ++hl+Ged+e+L + eL++Le+ +e++l+++
  EPS58809.1  75 ESNETTHMKVTHNWYASMGKELMDRTVDLKHLMGEDIEELGISELMKLEKTVETGLNRV 133
                 44666666777777777777777777889****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.819161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.62E-38376No hitNo description
SuperFamilySSF554554.58E-30389IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-778133IPR002487Transcription factor, K-box
PROSITE profilePS512977.19282135IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MVRQKIEIKK IDNVTARQVA FSKRRRGLFK KAHELSTLCD AEIGLVVFSS TGKLFDYASS  60
SMPELIRRHN MVSEESNETT HMKVTHNWYA SMGKELMDRT VDLKHLMGED IEELGISELM  120
KLEKTVETGL NRVEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-19184184Myocyte-specific enhancer factor 2B
1tqe_Q4e-19184184Myocyte-specific enhancer factor 2B
1tqe_R4e-19184184Myocyte-specific enhancer factor 2B
1tqe_S4e-19184184Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012828389.11e-59PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC16e-46SVP_ARATH; MADS-box protein SVP
TrEMBLS8BWR06e-96S8BWR0_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc01g105800.2.18e-47(Solanum lycopersicum)
STRINGPGSC0003DMT4000837395e-47(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-47MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]